RetrogeneDB ID: | retro_opri_783 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_3029:181324..181659(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RNF4 | ||
| Ensembl ID: | ENSOPRG00000004317 | ||
| Aliases: | None | ||
| Description: | ring finger protein 4 [Source:HGNC Symbol;Acc:10067] |
| Percent Identity: | 52.1 % |
| Parental protein coverage: | 61.62 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | TPEIALEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVVSR--RRPRRNARRLRQDHADSCVLSS |
| .P..ALEAE.IEL.E...DE.VDLTCES.EPVV.DLT..DSVV.....RRPRRN.R..RQ....SC..SS | |
| Retrocopy | SPDMALEAELIELGEN--DEVVDLTCESVEPVVIDLTCHDSVVITEQWRRPRRNTRS-RQTQTGSCAVSS |
| Parental | DEEELARDRDVYVTTHTP-TSARTDGAAGLRSSGTVS-CPICM-DGYSE |
| D.......RDVYV......T.....G.A.....G..S.C..CM.DGYSE | |
| Retrocopy | DGQWVS-NRDVYVARSAH>TILLEEGTASHLQPGYIS<CRVCM<DGYSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014366 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014856 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006675 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024877 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001683 | 3 retrocopies | |
| Felis catus | ENSFCAG00000004051 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007382 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005969 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000160 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004998 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004317 | 3 retrocopies |
retro_opri_112, retro_opri_783 , retro_opri_863,
|
| Procavia capensis | ENSPCAG00000004528 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025865 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000008690 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011101 | 2 retrocopies |