RetrogeneDB ID: | retro_shar_672 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL856984.1:1636011..1636373(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSHAG00000001478 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.92 % |
| Parental protein coverage: | 51.71 % |
| Number of stop codons detected: | 7 |
| Number of frameshifts detected | 1 |
| Parental | KMSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFN-LTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ |
| K..SS.EV.WI..FC...GN.FF.EVDED.I..KFN.LTG..EQV...RQ....I..L....ELEDN.N. | |
| Retrocopy | KIRSSQEVLWIL*FCRFCGNLFFYEVDEDSI*YKFN<LTGFTEQVLL*RQTIVRIRNL*LNKELEDNFN* |
| Parental | SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML |
| SDL.E....MLYGL.H...I..N..I..M.EK...GDFGYC..V.CENQ.ML | |
| Retrocopy | SDLVE*TVKMLYGLNHTFHIQANCDIT*MVEKHEEGDFGYCLNVCCENQSML |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000005751 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002996 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018728 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014179 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006417 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015168 | 3 retrocopies | |
| Felis catus | ENSFCAG00000007642 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004095 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000015287 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011129 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023483 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000012138 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001478 | 2 retrocopies |
retro_shar_672 , retro_shar_693,
|
| Sus scrofa | ENSSSCG00000001414 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014103 | 2 retrocopies |