RetrogeneDB ID: | retro_acar_107 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | 3:73316488..73316921(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSACAG00000006552 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSACAG00000005751 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 88.28 % |
| Parental protein coverage: | 61.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDF-GYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPK |
| LIEQAAEMLY.LIHA.YILTN.GI.Q.LEKYQQGDF.GYCP.VYCENQPMLP.GLSDIPGE.MVKLYCPK | |
| Retrocopy | LIEQAAEMLYELIHACYILTNCGITQLLEKYQQGDF>GYCPWVYCENQPMLPMGLSDIPGEVMVKLYCPK |
| Parental | CMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKS |
| CMD.YTPKSSRHHHTDGAYFGT.FPHMLFMVHP.Y..KRPANQFVPRLYGFKIHPM.YQLQLQA.SNFKS | |
| Retrocopy | CMDAYTPKSSRHHHTDGAYFGTSFPHMLFMVHPKYQLKRPANQFVPRLYGFKIHPMFYQLQLQANSNFKS |
| Parental | PVKTI |
| .VKTI | |
| Retrocopy | LVKTI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 0 .00 RPM | 37 .91 RPM |
| SRP009831_brain | 0 .00 RPM | 46 .06 RPM |
| SRP009831_dewlap | 0 .00 RPM | 91 .00 RPM |
| SRP009831_embryo | 0 .00 RPM | 88 .23 RPM |
| SRP009831_heart | 0 .00 RPM | 71 .13 RPM |
| SRP009831_liver | 0 .00 RPM | 67 .77 RPM |
| SRP009831_lung | 0 .00 RPM | 64 .63 RPM |
| SRP009831_ovary | 0 .00 RPM | 109 .11 RPM |
| SRP009831_skeletal_muscle | 0 .00 RPM | 75 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000005751 | 1 retrocopy |
retro_acar_107 ,
|
| Bos taurus | ENSBTAG00000008837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002996 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018728 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014179 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006417 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015168 | 3 retrocopies | |
| Felis catus | ENSFCAG00000007642 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004095 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000015287 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011129 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023483 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000012138 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001478 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000001414 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014103 | 2 retrocopies |