RetrogeneDB ID: | retro_sara_322 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_162523:1802..1999(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ISCU | ||
| Ensembl ID: | ENSSARG00000012942 | ||
| Aliases: | None | ||
| Description: | iron-sulfur cluster scaffold homolog (E. coli) [Source:HGNC Symbol;Acc:29882] |
| Percent Identity: | 52.94 % |
| Parental protein coverage: | 73.63 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | SAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAA-LADYKLKQEPKKGE |
| S..A.S.L......GK..EEALTI..TDI.KEL.L...KLHCS.L..DA.K...L.DYK..QE...GE | |
| Retrocopy | STLA*SLLVIRGMEGKREEEALTILSTDIIKELYLLSKKLHCSELGADAMKGT<LIDYK-NQESRSGE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000011773 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015374 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007942 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000002828 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012942 | 1 retrocopy |
retro_sara_322 ,
|
| Xenopus tropicalis | ENSXETG00000027428 | 1 retrocopy |