RetrogeneDB ID: | retro_sara_318 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_160120:941..1181(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | YPEL2 | ||
| Ensembl ID: | ENSSARG00000009791 | ||
| Aliases: | None | ||
| Description: | yippee-like 2 (Drosophila) [Source:HGNC Symbol;Acc:18326] |
| Percent Identity: | 85. % |
| Parental protein coverage: | 67.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | SFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIEL |
| S.QGSQG..YLFN.VVN.G.GPA.ERVLLTGLHAVADIYC.N.KTTLGWKYEHAFESSQKYKEG.Y.IEL | |
| Retrocopy | SLQGSQGCVYLFNLVVNMGHGPAKERVLLTGLHAVADIYCDNYKTTLGWKYEHAFESSQKYKEGEYFIEL |
| Parental | AHMIKDNGWD |
| .HMIKDNGWD | |
| Retrocopy | EHMIKDNGWD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000018575 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029581 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009791 | 2 retrocopies |
retro_sara_318 , retro_sara_650,
|
| Ictidomys tridecemlineatus | ENSSTOG00000001013 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013138 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005518 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000381 | 1 retrocopy |