RetrogeneDB ID: | retro_rnor_615 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 1:166112660..166112898(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Pdzd11 | ||
| Ensembl ID: | ENSRNOG00000002838 | ||
| Aliases: | Pdzd11, RGD1560007 | ||
| Description: | PDZ domain-containing protein 11 [Source:RefSeq peptide;Acc:NP_001100415] |
| Percent Identity: | 58.02 % |
| Parental protein coverage: | 57.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MDNRIPYDDYPVVFLPAYENPPAWIP-PHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQ |
| MD...P.D.YPVVFL.AYENPP.W...P..........N.LTQFLP.IVT.KK.PGAQL........A.Q | |
| Retrocopy | MDGWTPCDNYPVVFLSAYENPPVWMD>PTQERVYHTEYNDLTQFLPCIVTIKKLPGAQLCLTTK-KDAFQ |
| Parental | LGIFISKVIPD |
| LGIFISKVIP. | |
| Retrocopy | LGIFISKVIPN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 15 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000012860 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000210 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
| Felis catus | ENSFCAG00000008633 | 3 retrocopies | |
| Homo sapiens | ENSG00000120509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017101 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000001811 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002838 | 1 retrocopy |
retro_rnor_615 ,
|
| Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027107 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |