RetrogeneDB ID: | retro_rnor_2506 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 7:16680109..16680319(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RGD1562351 | ||
| Ensembl ID: | ENSRNOG00000042758 | ||
| Aliases: | Tmem243, RGD1562351 | ||
| Description: | None |
| Percent Identity: | 51.43 % |
| Parental protein coverage: | 59.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | SAKDRIINLVVGGLTTLLILVTLVSAFLFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRN |
| SA....I.L....LT.L.ILVTL...FLF.QL..K.LN..FA...SLSS.TACILIY.Y........F.N | |
| Retrocopy | SARSPDICLLGRSLTYLCILVTLSCVFLFSQLSTKQLNLVFALSMSLSSTTACILIY*YQXXXVWIEF*N |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .07 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004888 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000014707 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000023 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042758 | 1 retrocopy |
retro_rnor_2506 ,
|
| Sorex araneus | ENSSARG00000002439 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007846 | 3 retrocopies |