RetrogeneDB ID: | retro_rnor_2012 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:219503873..219504119(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Commd6 | ||
| Ensembl ID: | ENSRNOG00000038012 | ||
| Aliases: | Commd6, RGD1560745 | ||
| Description: | COMM domain-containing protein 6 [Source:RefSeq peptide;Acc:NP_001102575] |
| Percent Identity: | 82.93 % |
| Parental protein coverage: | 75.93 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | VLAISTLAMEGSQYREPVLDAKSEVTGQLVDFQWKLGMAVSSDSCRSLKYPYVAVLLKVADHSGQVSSKS |
| V.AISTLA.E.SQ.REPVLDAKS.VTGQL.DFQWKLGMAVSSDSCRSL.YP.V.V.LKV.D.SGQVSSKS | |
| Retrocopy | VFAISTLAKEESQFREPVLDAKSDVTGQLIDFQWKLGMAVSSDSCRSLRYP*VVVMLKVTDDSGQVSSKS |
| Parental | IEMTIPQFQNFY |
| .EMTIPQFQNF. | |
| Retrocopy | MEMTIPQFQNFH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .90 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .56 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .65 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000011048 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006061 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010697 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000970 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026952 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000038012 | 1 retrocopy |
retro_rnor_2012 ,
|
| Tursiops truncatus | ENSTTRG00000003379 | 2 retrocopies |