RetrogeneDB ID: | retro_rnor_1326 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 18:1792513..1792969(+) | ||
| Located in intron of: | ENSRNOG00000023492 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Sarnp | ||
| Ensembl ID: | ENSRNOG00000030520 | ||
| Aliases: | Sarnp, Cip29, RGD1305692 | ||
| Description: | SAP domain-containing ribonucleoprotein [Source:UniProtKB/Swiss-Prot;Acc:Q498U4] |
| Percent Identity: | 83.55 % |
| Parental protein coverage: | 72.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | ETEEEEPKPIELPVKEEEPPEKVVDMASEKKVVKITSGIPQTERMQKRAERFNVPVSLESKKAARAARFG |
| E......KP..LPVKEEEPPEKVV.M.SEKK.VK.TSGIP.TERMQK.AERFNVPVS.ESKKAARAARFG | |
| Retrocopy | EVKLRKKKPVDLPVKEEEPPEKVVGMSSEKKAVKSTSGIPLTERMQKSAERFNVPVSWESKKAARAARFG |
| Parental | ISSVPTKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEA |
| .SSVPTKGLSSDTKP.VNLDK.KERAQRFGLNVSSISR.SEDDEKL...KERFGIVT.SAGTGTTEDTEA | |
| Retrocopy | TSSVPTKGLSSDTKPVVNLDKRKERAQRFGLNVSSISRRSEDDEKLERWKERFGIVTRSAGTGTTEDTEA |
| Parental | KKRKRAERFGIA |
| KKRK.AE.FGIA | |
| Retrocopy | KKRKGAECFGIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .07 RPM | 31 .78 RPM |
| SRP017611_kidney | 0 .07 RPM | 26 .87 RPM |
| SRP017611_liver | 0 .07 RPM | 18 .89 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011769 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020662 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007853 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000011755 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001065 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000015176 | 1 retrocopy | |
| Homo sapiens | ENSG00000205323 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013217 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015053 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000010902 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028949 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000885 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000078427 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017599 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000009477 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000004630 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000029747 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000030520 | 2 retrocopies |
retro_rnor_1326 , retro_rnor_471,
|