RetrogeneDB ID: | retro_pvam_337 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_2633:457043..457259(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C2orf76 | ||
| Ensembl ID: | ENSPVAG00000011615 | ||
| Aliases: | None | ||
| Description: | chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017] |
| Percent Identity: | 80.56 % |
| Parental protein coverage: | 58.06 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | PFRNYKYDKLKIIHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIANETEIAFFCEEDYKNYKANPIS |
| PFRNYKYDKLK..HQA.KSKTNELVLSL.D.DR.LLK.DSTLKAA.I.NE.EIA...EE.YKNYKANPIS | |
| Retrocopy | PFRNYKYDKLKVVHQAYKSKTNELVLSLKDADRILLKKDSTLKAARITNENEIALLYEEEYKNYKANPIS |
| Parental | SW |
| SW | |
| Retrocopy | SW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008507 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000010599 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004896 | 2 retrocopies | |
| Equus caballus | ENSECAG00000002063 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004031 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000943 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026388 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011615 | 1 retrocopy |
retro_pvam_337 ,
|
| Sus scrofa | ENSSSCG00000015718 | 1 retrocopy |