RetrogeneDB ID: | retro_ptro_732 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 12:8228429..8228680(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSPTRG00000020264 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 [Source:HGNC Symbol;Acc:10405] |
| Percent Identity: | 51.16 % |
| Parental protein coverage: | 59.86 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | AFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKG-PVRMPTKTLRITTRKTPC |
| A....G.T..EPEV.IH..RIT.TS....SLEKVCAD.IR..K.KN...K..PV.M..........K.PC | |
| Retrocopy | ALQNSGNTLLEPEVTIH*MRITPTSHSGNSLEKVCADWIRDPKGKNPSLKN<PV*M-SRLQESLQEKQPC |
| Parental | GEGSKTWDRFQMRIHK |
| GE.S...D.FQMRI.K | |
| Retrocopy | GEDSRI*DHFQMRIRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 130 .86 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 99 .77 RPM |
| SRP007412_heart | 0 .00 RPM | 177 .47 RPM |
| SRP007412_kidney | 0 .00 RPM | 249 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 289 .27 RPM |
| SRP007412_testis | 0 .00 RPM | 175 .78 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1078 |
| Gorilla gorilla | retro_ggor_851 |
| Pongo abelii | retro_pabe_897 |