RetrogeneDB ID: | retro_ocun_299 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:117211089..117211299(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSOCUG00000003068 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 (RPS20), mRNA [Source:RefSeq mRNA;Acc:NM_001253734] |
| Percent Identity: | 70.83 % |
| Parental protein coverage: | 58.82 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | MAFKDTGKTPVEPEVAIHRIRITLTSRNVKS-LEKVCADLIRGAKEKNLKVKGPVRMP-TKTLRITTRKT |
| .AFKDTGK.P...EVAIH.IRITLT...VKS..EK.C.DLIRGA.EKNL.VKG.V.MP..KTLRI.TRK. | |
| Retrocopy | IAFKDTGKMPMKTEVAIH*IRITLTIN*VKS<MEKMCVDLIRGAREKNLNVKGSVQMP>NKTLRIITRKI |
| Parental | PC |
| PC | |
| Retrocopy | PC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 90 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 175 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 83 .40 RPM |