RetrogeneDB ID: | retro_ptro_3096 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | X:24732712..24732942(+) | ||
| Located in intron of: | ENSPTRG00000021750 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPEL1 | ||
| Ensembl ID: | ENSPTRG00000030224 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.42 % |
| Parental protein coverage: | 82.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PINL--IFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIML-KGDN |
| PINL..IFRYLQNRSRIQVWLYEQVNM.IEG..IGFDE..NL..DDAE.IH..TK.RK.LG.I.L.KGD. | |
| Retrocopy | PINLTFIFRYLQNRSRIQVWLYEQVNMLIEGRVIGFDESVNLISDDAEAIHCETKPRKPLGQIVL<KGDH |
| Parental | ITLLQSVSN |
| I.L.Q.VSN | |
| Retrocopy | I-LPQNVSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .39 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 6 .20 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .41 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4660 |
| Gorilla gorilla | retro_ggor_2892 |
| Pongo abelii | retro_pabe_3620 |
| Macaca mulatta | retro_mmul_2480 |