RetrogeneDB ID: | retro_mmul_2480 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:22344172..22344393(+) | ||
| Located in intron of: | ENSMMUG00000012819 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.2197 | ||
| Ensembl ID: | ENSMMUG00000031372 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein E [Source:RefSeq peptide;Acc:NP_001253704] |
| Percent Identity: | 72.37 % |
| Parental protein coverage: | 81.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | INLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIML-KGDNITL |
| ...IFRYLQNRSRIQV.LYEQVNM.IEG.IIGFDE..NL..DDAEEIH..TK.RK.LG.I.L.KGD.I.L | |
| Retrocopy | LTFIFRYLQNRSRIQV*LYEQVNMLIEGRIIGFDESVNLISDDAEEIHCETKPRKPLGQIVL<KGDHI-L |
| Parental | LQSVSN |
| .Q.VSN | |
| Retrocopy | PQNVSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 9 .97 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .55 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .15 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .52 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4660 |
| Pan troglodytes | retro_ptro_3096 |
| Gorilla gorilla | retro_ggor_2892 |
| Pongo abelii | retro_pabe_3620 |