RetrogeneDB ID: | retro_ptro_258 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:212059218..212059790(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C9orf78 | ||
| Ensembl ID: | ENSPTRG00000021465 | ||
| Aliases: | None | ||
| Description: | chromosome 9 open reading frame 78 [Source:HGNC Symbol;Acc:24932] |
| Percent Identity: | 54.27 % |
| Parental protein coverage: | 67.82 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | EEDEQDSEEVRLKLEETREVQNLRKR-PNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKERG |
| .EDEQD.EE...KL.ET.EVQ.LRK.....V.AVAL..GE..Q.E.TLV.D..Q.KT.G...M....E.G | |
| Retrocopy | QEDEQD*EEI*FKLKETGEVQDLRKK<TRHVRAVALQMGEGIQVEATLVGDFLQIKT-GSMYMGQ-EEKG |
| Parental | KDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEH-EEQKVKPKNAEDCLYELPENIRV |
| .D.IS.EEDL....SFS.ETN...E....MKY.ET..K.RKG...H..EQK.K.K.AEDCLYEL.EN... | |
| Retrocopy | MDGISKEEDLQPRMSFSEETNPG*EGMSVMKYMETKTKQRKGLLDH<QEQKIKLKSAEDCLYELSENTCL |
| Parental | -SSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFV |
| .SS.K...EML..Q.....P.VD...DA.I...I.T..AKA.LLAE.QNKKKD.ETS.V | |
| Retrocopy | >SSKK-AKEMLPTQCWVH-PKVDVCTDAEIE-CIATKEAKAWLLAEDQNKKKDIETSCV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 76 .32 RPM |
| SRP007412_heart | 0 .09 RPM | 39 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 46 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 37 .58 RPM |
| SRP007412_testis | 0 .63 RPM | 106 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_320 |
| Callithrix jacchus | retro_cjac_1757 |
| Bos taurus | retro_btau_1138 |
| Equus caballus | retro_ecab_174 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019979 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013895 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020318 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019214 | 1 retrocopy | |
| Homo sapiens | ENSG00000136819 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013358 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010524 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000003795 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000006832 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017658 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000009770 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019685 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021465 | 3 retrocopies |
retro_ptro_1943, retro_ptro_1969, retro_ptro_258 ,
|
| Sarcophilus harrisii | ENSSHAG00000012313 | 1 retrocopy |