RetrogeneDB ID: | retro_ptro_2316 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:181717446..181717726(-) | ||
| Located in intron of: | ENSPTRG00000017636 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PLP2 | ||
| Ensembl ID: | ENSPTRG00000021885 | ||
| Aliases: | None | ||
| Description: | proteolipid protein 2 (colonic epithelium-enriched) [Source:HGNC Symbol;Acc:9087] |
| Percent Identity: | 69.15 % |
| Parental protein coverage: | 59.21 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | FFVVYMCDLHTKIPFINWPWSDFLRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYV- |
| .FV.Y.CDLHTKIPFINWPWS.F..TL.A.IL.LITSI...VE.GNHSKI.AGVLGLIA..LFG..AYV. | |
| Retrocopy | YFVSYVCDLHTKIPFINWPWSHFFQTLLAVIL*LITSIIDNVEKGNHSKIIAGVLGLIAKGLFGFNAYV> |
| Parental | TFPVRQPRHT---AAPTDPADGPV |
| TFP....R.T...AAPT.P.DGPV | |
| Retrocopy | TFPFQ*QRYTRYTAAPTGPTDGPV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 1 .98 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .97 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .58 RPM |
| SRP007412_kidney | 0 .03 RPM | 9 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .90 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3411 |
| Macaca mulatta | retro_mmul_2124 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012288 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000016093 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000015798 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003820 | 2 retrocopies | |
| Homo sapiens | ENSG00000102007 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004483 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000023022 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013817 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000031146 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001317 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003865 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000021885 | 1 retrocopy |
retro_ptro_2316 ,
|
| Tursiops truncatus | ENSTTRG00000016968 | 2 retrocopies |