RetrogeneDB ID: | retro_ptro_1678 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2B:226616012..226616207(+) | ||
| Located in intron of: | ENSPTRG00000012967 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000030987 | ||
| Aliases: | TMEM256, C17H17orf61 | ||
| Description: | None |
| Percent Identity: | 66.15 % |
| Parental protein coverage: | 57.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAGPAAVFRRLGALSGAAALGFASYGAHGAQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPL |
| .AGP.A.F..LG.LS.A.ALG.AS.G.H..QF.DAY.KELFD.AN.HHF.HSLALL...HCR.PL | |
| Retrocopy | LAGPGAAFCHLGTLSVAGALGLAS*GVHTTQFLDAYWKELFDTANSHHFSHSLALLRGLHCRSPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 8 .38 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .41 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .09 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .74 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2212 |
| Gorilla gorilla | retro_ggor_1745 |
| Pongo abelii | retro_pabe_2084 |
| Macaca mulatta | retro_mmul_929 |