RetrogeneDB ID: | retro_cfam_1965 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 8:58301240..58301412(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCAFG00000023205 | ||
| Aliases: | TMEM256, C5H17orf61 | ||
| Description: | None |
| Percent Identity: | 60.34 % |
| Parental protein coverage: | 50.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MAGFGAAFRRLGALSGAGAL-GLASYGAHGAQFPDAYGKELFDKTNRHHFLHSLALLG |
| MA..G.AF..L..LS.A..L..LA.Y..HG.QFPD.Y.KELFDKT....FLHSLA.LG | |
| Retrocopy | MARPGVAFCHLSVLSRAESL>CLACYRVHGTQFPDVYRKELFDKTSKYLFLHSLAVLG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 6 .59 RPM |
| SRP017611_brain | 0 .00 RPM | 3 .26 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .56 RPM |