RetrogeneDB ID: | retro_ptro_1409 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 20:60228521..60228767(+) | ||
| Located in intron of: | ENSPTRG00000013720 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DPH3 | ||
| Ensembl ID: | ENSPTRG00000014671 | ||
| Aliases: | None | ||
| Description: | diphthamide biosynthesis 3 [Source:HGNC Symbol;Acc:27717] |
| Percent Identity: | 87.8 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIVKVIYDKDQFVCGETV |
| MAVFHDEVEIEDFQYDEDSETYF.PCPCGDNFSITKE.LENGE.VA.CP.CSLI.KVIYDKDQF.CGETV | |
| Retrocopy | MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETV |
| Parental | PAPSANKELVKC |
| P.PS.NKE.VKC | |
| Retrocopy | PVPSVNKE*VKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .77 RPM | 4 .95 RPM |
| SRP007412_cerebellum | 0 .32 RPM | 5 .27 RPM |
| SRP007412_heart | 0 .85 RPM | 6 .82 RPM |
| SRP007412_kidney | 0 .65 RPM | 6 .07 RPM |
| SRP007412_liver | 0 .16 RPM | 5 .14 RPM |
| SRP007412_testis | 0 .42 RPM | 9 .70 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2438 |
| Gorilla gorilla | retro_ggor_174 |
| Pongo abelii | retro_pabe_1795 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
| Homo sapiens | ENSG00000154813 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy |
retro_ptro_1409 ,
|
| Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |