RetrogeneDB ID: | retro_dord_167 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | GeneScaffold_4246:52581..52827(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Dph3 | ||
| Ensembl ID: | ENSDORG00000011642 | ||
| Aliases: | None | ||
| Description: | DPH3 homolog (KTI11, S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1922658] |
| Percent Identity: | 96.34 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAVFHDEVEIEDFQYDEDSETFFYPCPCGDNFSITKEDLENGEEVATCPSCSLIIKVIYDKDQFMCGETI |
| MAVFHDEVEIEDFQYDED.ET.FYPCPCGD.FSITKEDLENGEEVATCPSCSLIIKVIYDKDQFMCGETI | |
| Retrocopy | MAVFHDEVEIEDFQYDEDLETYFYPCPCGDKFSITKEDLENGEEVATCPSCSLIIKVIYDKDQFMCGETI |
| Parental | PAPSANKELVKC |
| PAPSANKELVKC | |
| Retrocopy | PAPSANKELVKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy |
retro_dord_167 ,
|
| Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
| Homo sapiens | ENSG00000154813 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |