RetrogeneDB ID: | retro_ptro_1071 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 15:71029193..71029598(-) | ||
| Located in intron of: | ENSPTRG00000007259 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPS15 | ||
| Ensembl ID: | ENSPTRG00000000541 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.57 % |
| Parental protein coverage: | 53.31 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | YVIRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDT |
| Y.I.KP...R.D.D.P.S.LLKD.Q..PGIEK..D.VKR.LSLEM.N.KE.L.IK.E..M.K.VANP.DT | |
| Retrocopy | YTIQKPVWPRQDHDLPLSMLLKDHQTIPGIEKGNDTVKRSLSLEMTNQKEKLNIK*EHLMNKVVANPKDT |
| Parental | RSLEARIIALSVKIRSYEEH-LEKHRKDKAHKRY-LLMSIDQRKKMLKNLRNTN-YDVFEKICLGLGIEY |
| ..LEARII.L..K...YEEH...KH...K.HK.Y.L.M...QRKKMLKNLR.TN.YDV.EK...GL.... | |
| Retrocopy | SFLEARIIPLT-KAHNYEEH<QQKH*NNKTHKYY<LVMGTVQRKKMLKNLR*TN<YDVSEKTHWGLSTSF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .88 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 16 .45 RPM |
| SRP007412_heart | 0 .00 RPM | 36 .29 RPM |
| SRP007412_kidney | 0 .00 RPM | 45 .69 RPM |
| SRP007412_liver | 0 .00 RPM | 39 .44 RPM |
| SRP007412_testis | 0 .11 RPM | 187 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1594 |
| Pongo abelii | retro_pabe_1310 |
| Callithrix jacchus | retro_cjac_761 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001463 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000030390 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001852 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010877 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007581 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005265 | 1 retrocopy | |
| Homo sapiens | ENSG00000116898 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006475 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028861 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011467 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002656 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001537 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000541 | 1 retrocopy |
retro_ptro_1071 ,
|
| Sus scrofa | ENSSSCG00000026393 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000608 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000958 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008948 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002345 | 1 retrocopy |