RetrogeneDB ID: | retro_pabe_1310 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 15:70888320..70888752(-) | ||
| Located in intron of: | ENSPPYG00000006624 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPS15 | ||
| Ensembl ID: | ENSPPYG00000001537 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S15 [Source:HGNC Symbol;Acc:14504] |
| Percent Identity: | 58.39 % |
| Parental protein coverage: | 57.48 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | SLLLQAARG-YVIRKPAQPRQDDDPPPSTLLKDYQNVPGIEKVDDVVKRILSLEMANKKETLKAKREQFM |
| SLLLQAA...Y.I.KP..PRQD.D.P.S.LLKD.Q..P.IEK..D.VKR.LSLEM.N.KE.L..K.E..M | |
| Retrocopy | SLLLQAAAD<YTIQKPVWPRQDHDLPLSMLLKDHQTIPEIEKGNDTVKRPLSLEMTNQKEKLNIK*EHLM |
| Parental | KKIVANPEDTRSLEARIIALSVKIRSYEEH-LEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTN-YDVFEK |
| .K.VANP.DT...EARII.L..K...YEEH...K..K.K.HK.YL.M...QRKKMLKNLR.TN.YDV.E. | |
| Retrocopy | NKVVANPKDTSFPEARIIPLT-KAHNYEEH<WQKN*KNKTHKYYLVMGTVQRKKMLKNLR*TN<YDVSER |
| Parental | ICRGLGIEY |
| ...GL.... | |
| Retrocopy | THWGLSTPF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 34 .06 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 26 .39 RPM |
| SRP007412_heart | 0 .03 RPM | 33 .44 RPM |
| SRP007412_kidney | 0 .07 RPM | 48 .76 RPM |
| SRP007412_liver | 0 .03 RPM | 43 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1594 |
| Pan troglodytes | retro_ptro_1071 |
| Callithrix jacchus | retro_cjac_761 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001463 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000030390 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001852 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010877 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007581 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005265 | 1 retrocopy | |
| Homo sapiens | ENSG00000116898 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006475 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028861 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011467 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002656 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001537 | 1 retrocopy |
retro_pabe_1310 ,
|
| Pan troglodytes | ENSPTRG00000000541 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026393 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000608 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000958 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008948 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002345 | 1 retrocopy |