RetrogeneDB ID: | retro_pabe_3509 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 9:124203750..124203978(-) | ||
| Located in intron of: | ENSPPYG00000019619 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DENR | ||
| Ensembl ID: | ENSPPYG00000005073 | ||
| Aliases: | None | ||
| Description: | density-regulated protein [Source:HGNC Symbol;Acc:2769] |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 50.33 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGGKCSFPTWYCEYMPDVAKCRQWLEKNFPNEFAKLT |
| MAADISES.GA.CKGD.RN.A.LDAD.PL.VL.C...CS.PT.YC.Y.P.VAKCRQWLEKNFPNEFAKLT | |
| Retrocopy | MAADISESNGAKCKGDLRNRAELDADCPL*VLHCR-VCSLPTGYCKYTPNVAKCRQWLEKNFPNEFAKLT |
| Parental | VENSPKQ |
| VEN.PKQ | |
| Retrocopy | VENLPKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .26 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .49 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .49 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000016012 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000032433 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020488 | 4 retrocopies | |
| Homo sapiens | ENSG00000139726 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005562 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002186 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008150 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000015974 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000005073 | 3 retrocopies |
retro_pabe_1821, retro_pabe_3509 , retro_pabe_861,
|
| Pan troglodytes | ENSPTRG00000005584 | 4 retrocopies |