RetrogeneDB ID: | retro_pabe_3001 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:128780206..128780389(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PPP1R14C | ||
| Ensembl ID: | ENSPPYG00000017102 | ||
| Aliases: | None | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 14C [Source:HGNC Symbol;Acc:14952] |
| Percent Identity: | 60.66 % |
| Parental protein coverage: | 67.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | EEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFIKELLSRIRGMRKLSPPQKK |
| E.E.PE.EID.D.LLD..S....A....E.LVDCYKPTE.FI..LL..I.GM.KLS.PQKK | |
| Retrocopy | EKEIPELEIDVDELLDMESEDAQAARVKELLVDCYKPTEAFISDLLDKIWGMQKLSTPQKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .11 RPM |
| SRP007412_cerebellum | 0 .24 RPM | 1 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .56 RPM |
| SRP007412_liver | 0 .06 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000026586 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017261 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000023245 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000040653 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017102 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002873 | 1 retrocopy |