RetrogeneDB ID: | retro_pabe_2329 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:107098630..107099089(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NFU1 | ||
| Ensembl ID: | ENSPPYG00000012339 | ||
| Aliases: | None | ||
| Description: | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:16287] |
| Percent Identity: | 76.62 % |
| Parental protein coverage: | 74.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | FVQRPL-FPLP-AAF---CNTQLFRVEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLP |
| F..RP..FP.P.AAF......QLFR.EGVKSVFFGPDFIT.TKENE.LDWNLLKPDIY.T..DFFASGL. | |
| Retrocopy | FETRPMDFPTPAAAFRSPLDRQLFRIEGVKSVFFGPDFITATKENEKLDWNLLKPDIYTTTTDFFASGLS |
| Parental | LVTEETPSGEAGSEEDDEVVAMIKELLDTRI-RTVQEDGGDVIYKGF-DGIVQL-LQGSCTSCPSSIITL |
| LVTEET.SGEAG..EDDEVVA.IKE.LDTR...TVQEDGGDVIYKGF.DGIV.L.LQGSCTSCPSSIITL | |
| Retrocopy | LVTEETSSGEAGC-EDDEVVALIKEVLDTRMWPTVQEDGGDVIYKGFEDGIV*LKLQGSCTSCPSSIITL |
| Parental | -NGIQ-MLQFVMDD |
| .NGIQ.MLQF.... | |
| Retrocopy | KNGIQNMLQFYIPE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 1 .05 RPM | 4 .81 RPM |
| SRP007412_cerebellum | 1 .58 RPM | 4 .62 RPM |
| SRP007412_heart | 3 .58 RPM | 12 .61 RPM |
| SRP007412_kidney | 3 .71 RPM | 13 .09 RPM |
| SRP007412_liver | 1 .81 RPM | 6 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2638 |
| Pan troglodytes | retro_ptro_1778 |
| Macaca mulatta | retro_mmul_1524 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005978 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019156 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019002 | 1 retrocopy | |
| Homo sapiens | ENSG00000169599 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000435 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011805 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006663 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000029993 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010101 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016760 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012339 | 1 retrocopy |
retro_pabe_2329 ,
|
| Pan troglodytes | ENSPTRG00000012016 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008616 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013765 | 1 retrocopy |