RetrogeneDB ID: | retro_pabe_1971 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2a:91747347..91747718(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS25 | ||
| Ensembl ID: | ENSPPYG00000025915 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
| Percent Identity: | 79.37 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITP |
| MPPKD.KKKKDAGK.A.KDKDPV.KS..KAKKK..SK..V.DK.NNLVLFDK.T.DK.CK.VPN.KL.TP | |
| Retrocopy | MPPKDKKKKKDAGKLARKDKDPVSKSRDKAKKK-CSKDIVQDKPNNLVLFDKTT*DKPCKDVPNCKLTTP |
| Parental | AVVSERLKIRGSLARAA-LQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA |
| A.VS.RLKIR.SLARAA.LQELLSKGLIKLVSKHR.QVIY.RNTKG.DAPAAGE.A | |
| Retrocopy | AMVSKRLKIRVSLARAA<LQELLSKGLIKLVSKHRVQVIYSRNTKGRDAPAAGEKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 63 .53 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 76 .24 RPM |
| SRP007412_heart | 0 .00 RPM | 100 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 140 .58 RPM |
| SRP007412_liver | 0 .06 RPM | 145 .20 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2233 |
| Pan troglodytes | retro_ptro_1579 |
| Gorilla gorilla | retro_ggor_1666 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
| Homo sapiens | ENSG00000118181 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies | |
| Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
| Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
| Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
| Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies | |
| Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |