RetrogeneDB ID: | retro_pabe_1185 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:66442037..66442344(-) | ||
| Located in intron of: | ENSPPYG00000005913 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF1AX | ||
| Ensembl ID: | ENSPPYG00000020176 | ||
| Aliases: | None | ||
| Description: | Eukaryotic translation initiation factor 1A, X-chromosomal [Source:UniProtKB/Swiss-Prot;Acc:Q5RA42] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 72.22 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 1 |
| Parental | KRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRD-YQDNKADV |
| K.EL..K.D.QE...VIKM.GN..LE.MCFDGVKRLCH.RGKLRKK..INTSD.ILVGL.D..QDNK.DV | |
| Retrocopy | KGELAYKGDRQE*--VIKMKGNR*LESMCFDGVKRLCHMRGKLRKKR*INTSDTILVGL*D>DQDNKSDV |
| Parental | ILKYNADEARSLKAYGELPEHAKINETDTFGPGDD |
| ILKYNA.EARSLKAYG...E.AKIN.T...GP.DD | |
| Retrocopy | ILKYNAHEARSLKAYGKFLESAKINKTNILGPRDD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .63 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 110 .17 RPM |
| SRP007412_heart | 0 .00 RPM | 35 .31 RPM |
| SRP007412_kidney | 0 .00 RPM | 39 .58 RPM |
| SRP007412_liver | 0 .00 RPM | 28 .83 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1431 |
| Pan troglodytes | retro_ptro_978 |
| Gorilla gorilla | retro_ggor_1103 |
| Sus scrofa | retro_sscr_948 |
| Equus caballus | retro_ecab_634 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017633 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007518 | 3 retrocopies | |
| Homo sapiens | ENSG00000173674 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020176 | 1 retrocopy |
retro_pabe_1185 ,
|
| Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000013528 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010995 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029864 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002012 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009927 | 4 retrocopies |