RetrogeneDB ID: | retro_opri_725 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_2627:40973..41292(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | POLR2D | ||
| Ensembl ID: | ENSOPRG00000005327 | ||
| Aliases: | None | ||
| Description: | polymerase (RNA) II (DNA directed) polypeptide D [Source:HGNC Symbol;Acc:9191] |
| Percent Identity: | 55.14 % |
| Parental protein coverage: | 88.89 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | MLLEHRKQQNESAEDEQELSEVFMKTLTYTARFSRFKNRETIASVRSLLLQKKLHKF-ELACLANLCPET |
| .LLEH.KQQN.SA..EQEL.E.FM.TLT.TA..S.F.NR.T.....SLLLQK......ELAC........ | |
| Retrocopy | LLLEHQKQQNKSADGEQELLETFM*TLTDTACISHFENRGTMTRIHSLLLQKMFLEL>ELACFGQP*SRV |
| Parental | AEES--KALIPSLEGRFEDEELQQILDDIQTKRSFQY |
| ...S..K.LIP.L.GR.EDEELQ.ILDD..TK..F.Y | |
| Retrocopy | CQRSLRKSLIPGLKGRLEDEELQKILDDA*TKHNFRY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies |
retro_opri_233, retro_opri_725 ,
|
| Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |