RetrogeneDB ID: | retro_opri_630 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_2035:13257..13470(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDRG1 | ||
| Ensembl ID: | ENSOPRG00000006403 | ||
| Aliases: | None | ||
| Description: | p53 and DNA-damage regulated 1 [Source:HGNC Symbol;Acc:16119] |
| Percent Identity: | 61.11 % |
| Parental protein coverage: | 92.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | GSMFIKMPHPQTKEMIEKDQDHLDKEIDRLRKQLKVKVSRLLEAQGKPELKGFNLNPLNQDELKALKVIL |
| GS.FI.M.HP.TKE.I.KDQD...K.........KV....L.EAQ.KPELK.FNLN.LNQDELKAL..IL | |
| Retrocopy | GSIFIRMVHPPTKEVIKKDQD-IWKQKGQTAERIKVEINLLFEAQDKPELKDFNLNSLNQDELKALNIIL |
| Parental | KG |
| KG | |
| Retrocopy | KG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020766 | 1 retrocopy | |
| Homo sapiens | ENSG00000088356 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024924 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003915 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007377 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000973 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009712 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016709 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006403 | 1 retrocopy |
retro_opri_630 ,
|
| Pongo abelii | ENSPPYG00000010897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013368 | 1 retrocopy |