RetrogeneDB ID: | retro_cjac_3320 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:82862638..82862905(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000011474 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDRG1 | ||
| Ensembl ID: | ENSCJAG00000020766 | ||
| Aliases: | None | ||
| Description: | p53 and DNA-damage regulated 1 [Source:HGNC Symbol;Acc:16119] |
| Percent Identity: | 63.33 % |
| Parental protein coverage: | 67.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | EELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLNPSEDVMVCFGSMFIKMPHPETKEMIEKDQDQLDK |
| EEL.EEVL..K.QIVD.D.KRNQN.E.LRALQ..L..SEDV.VCFG.M.IKMPHP..KE.IEK..D.LDK | |
| Retrocopy | EELVEEVLVNKQQIVDVDPKRNQNPECLRALQNGLSLSEDV-VCFGNMLIKMPHPRMKETIEKNRDHLDK |
| Parental | EIEKLRKQLKVKVNRLFEAQ |
| EIE...KQ......R..E.Q | |
| Retrocopy | EIEII*KQ*GPRQTRAEEFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 4 .66 RPM |
| SRP051959_heart | 0 .04 RPM | 10 .26 RPM |
| SRP051959_kidney | 0 .02 RPM | 7 .70 RPM |
| SRP051959_liver | 0 .00 RPM | 6 .04 RPM |
| SRP051959_lung | 0 .00 RPM | 10 .05 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 12 .10 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 11 .62 RPM |
| SRP051959_spleen | 0 .00 RPM | 12 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020766 | 1 retrocopy |
retro_cjac_3320 ,
|
| Homo sapiens | ENSG00000088356 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024924 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003915 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007377 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000973 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009712 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016709 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006403 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013368 | 1 retrocopy |