RetrogeneDB ID: | retro_opri_604 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_19104:18992..19207(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDCD5 | ||
| Ensembl ID: | ENSOPRG00000016642 | ||
| Aliases: | None | ||
| Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
| Percent Identity: | 71.23 % |
| Parental protein coverage: | 64.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | EAEMRNSILAQVLDQSA-RARLSNLALVKPEKSKAVENYLI-QMARYGQLSGKVSEQGLIEILEKVSQQT |
| .AEMRNS...QVLDQSA..ARL.NLA..KPEKSKAVEN.L..Q.ARY.QL...VSEQGL.E.LEKVSQQ. | |
| Retrocopy | QAEMRNSVSVQVLDQSA<LARLTNLAPEKPEKSKAVENMLLTQRARYKQLHNQVSEQGLMETLEKVSQQA |
| Parental | EKK |
| E.K | |
| Retrocopy | ESK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |