RetrogeneDB ID: | retro_ogar_896 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873530.1:17024461..17024703(+) | ||
| Located in intron of: | ENSOGAG00000012432 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA12 | ||
| Ensembl ID: | ENSOGAG00000010853 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [Source:HGNC Symbol;Acc:23987] |
| Percent Identity: | 70.73 % |
| Parental protein coverage: | 55.86 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | YLRVFFRANDVRVGTLVGQDKYGNRYYEDNKQF-FGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLH |
| .L..FFRANDV.VG.LVG.DKYGN..YEDNKQF.FG.H.WVIY.T.MN.KNTF.D.DGSMVPPE.H...H | |
| Retrocopy | WL*IFFRANDVKVGILVGKDKYGNKSYEDNKQF<FGCHQWVIYITKMNAKNTF*DMDGSMVPPEYHCCFH |
| Parental | CMTDDPPTVKPP |
| C.TDD.PT.K.P | |
| Retrocopy | CITDDLPTTKLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |