RetrogeneDB ID: | retro_cjac_1862 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:160132089..160132326(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA12 | ||
| Ensembl ID: | ENSCJAG00000002846 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [Source:HGNC Symbol;Acc:23987] |
| Percent Identity: | 56.96 % |
| Parental protein coverage: | 91.86 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | KRGLQQVTGHGGLRGYLRMLFRVNDVKIGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDV |
| K..L.QV..HG.L..YL...FR.ND...G..V.EDK.GNK.YEDNK.F.G.HR.VIY.TE.NG..T.W.. | |
| Retrocopy | KK*LLQVSSHGSLHSYLIIFFRANDMRVGIFVWEDK*GNKCYEDNKWFSGHHREVIYATEINGRSTSWAM |
| Parental | DGSMVPPEW |
| .GS.VP.EW | |
| Retrocopy | GGSLVPLEW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 3 .59 RPM |
| SRP051959_heart | 0 .14 RPM | 16 .52 RPM |
| SRP051959_kidney | 0 .04 RPM | 5 .10 RPM |
| SRP051959_liver | 0 .24 RPM | 7 .45 RPM |
| SRP051959_lung | 0 .11 RPM | 2 .31 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 1 .96 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 18 .96 RPM |
| SRP051959_spleen | 0 .13 RPM | 2 .94 RPM |