RetrogeneDB ID: | retro_ogar_1967 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873578.1:5769413..5769629(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CRIPT | ||
| Ensembl ID: | ENSOGAG00000008089 | ||
| Aliases: | None | ||
| Description: | cysteine-rich PDZ-binding protein [Source:HGNC Symbol;Acc:14312] |
| Percent Identity: | 80.56 % |
| Parental protein coverage: | 71.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | ESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICSMCGKKVLDTKNYK |
| ESGGRKLN.NKALT......D.Y.KNKFSTCRICKSSVHQPGSHYCQGCA.KKGI.S..GKKVLDTKNY. | |
| Retrocopy | ESGGRKLNVNKALTXXXXXVDLYRKNKFSTCRICKSSVHQPGSHYCQGCASKKGIFSVYGKKVLDTKNYE |
| Parental | QT |
| QT | |
| Retrocopy | QT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
| Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012342 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies |
retro_ogar_1206, retro_ogar_1967 , retro_ogar_2609, retro_ogar_2734, retro_ogar_3132, retro_ogar_984,
|
| Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |