RetrogeneDB ID: | retro_mmul_1191 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 15:70301803..70302106(-) | ||
| Located in intron of: | ENSMMUG00000015985 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.1662 | ||
| Ensembl ID: | ENSMMUG00000005388 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 96.04 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS |
| MVCEKCEKKLGTV.TPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS | |
| Retrocopy | MVCEKCEKKLGTVTTPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS |
| Parental | HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV |
| HYCQGCAYKKGICA.CGKKVLD.KNY.QTSV | |
| Retrocopy | HYCQGCAYKKGICATCGKKVLDNKNYRQTSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 19 .72 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 11 .34 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 18 .73 RPM |
| SRP007412_heart | 0 .06 RPM | 11 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .07 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .87 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .35 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
| Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012342 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy |
retro_mmul_1191 ,
|
| Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |