RetrogeneDB ID: | retro_ocun_882 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 16:84191480..84191719(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNAJC15 | ||
| Ensembl ID: | ENSOCUG00000001696 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
| Percent Identity: | 56.79 % |
| Parental protein coverage: | 53.69 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | AFQIWKPLEQVITEATRKISTPSFSSYYKGGFEQKMSRREASLILGVSPSAGKAKIRTAHRRIMI-LNHP |
| A.QIWKPLEQVITE...K..T...S.....GF..KMSR.EASL.LG...SA..A..R.AHRRI.I...HP | |
| Retrocopy | ARQIWKPLEQVITETAKKMPTAKLSFSSREGFGEKMSR*EASLALGAGSSAAEAGTRAAHRRIAI<SDHP |
| Parental | DKGGSPYLATK |
| DK...P..ATK | |
| Retrocopy | DKVDCPNPATK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 11 .98 RPM |
| SRP017611_kidney | 0 .00 RPM | 17 .94 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .00 RPM |