RetrogeneDB ID: | retro_itri_1710 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393650.1:351763..351982(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNAJC15 | ||
| Ensembl ID: | ENSSTOG00000012805 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
| Percent Identity: | 57.33 % |
| Parental protein coverage: | 66.37 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | SSSSLSSYYKGGFEQKMSRREASLILGVSPSAGKAKIRMAHKRIMILNHPDKGGSPYLATKINEAKDLLE |
| .S...SS..KGG.E.KM.R.E.S.ILGV..S.GK.KI.MAH.RIMILN.PDK.G...L.....EAKDL.E | |
| Retrocopy | TSRKISSFSKGGCEEKMRR*ETSVILGVNTSPGKGKIGMAHRRIMILN*PDKAGC--L*INNSEAKDLPE |
| Parental | ATTKY |
| A..K. | |
| Retrocopy | AISKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |