RetrogeneDB ID: | retro_ocun_613 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 13:61416403..61416766(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GMNN | ||
| Ensembl ID: | ENSOCUG00000000728 | ||
| Aliases: | None | ||
| Description: | geminin, DNA replication inhibitor [Source:HGNC Symbol;Acc:17493] |
| Percent Identity: | 56.8 % |
| Parental protein coverage: | 58.65 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 3 |
| Parental | TAKTSSPGVVTVSEHSENKNLEGVTQ-EAFDLMVKENASSQYWKEVAENRRKALYETLKENEK-LHKEIE |
| T...SS.GV..V.EHSENKNLEGVT..E.FD...KEN......KEVA...RK.L...L......L.KEI. | |
| Retrocopy | THESSSSGVFIVPEHSENKNLEGVTE<EPFDFLIKENPFP*S*KEVAKKWRKSLCKALS*SSN<LCKEIK |
| Parental | QKDNEIARLKKENKELAEVAEHVQ-YMAQVIETLSDRTLHDFESPDSQEFDSEEE |
| .KDN.I..LKKEN.EL.EVAEHVQ...A.VI....D..L.DFES.DSQEFD..EE | |
| Retrocopy | *KDNAICHLKKENTELEEVAEHVQ<VVAKVIGRVNDGLLADFESLDSQEFDYKEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .84 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006161 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000014010 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014849 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000011682 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000006715 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000728 | 1 retrocopy |
retro_ocun_613 ,
|
| Otolemur garnettii | ENSOGAG00000004982 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000007969 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018782 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004058 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010502 | 2 retrocopies |