RetrogeneDB ID: | retro_ocun_368 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:59182374..59182608(-) | ||
| Located in intron of: | ENSOCUG00000009437 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSOCUG00000026252 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
| Percent Identity: | 58.97 % |
| Parental protein coverage: | 66.1 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 0 |
| Parental | QQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSSEVEKETQ |
| QQ.LQ..K.A...VS.A.K...R.....KE.AQAE.E.Y.L..EK.FK..E.AALGS.GSCS.EV.KETQ | |
| Retrocopy | QQMLQDKKWAVKMVSKAPKQRTRG*SRPKEKAQAETE*YQL**EKKFKSRESAALGSQGSCSTEVRKETQ |
| Parental | EKMTILQT |
| EKMTI..T | |
| Retrocopy | EKMTIIYT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 52 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 64 .16 RPM |
| SRP017611_liver | 0 .00 RPM | 26 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012509 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Felis catus | ENSFCAG00000000160 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001653 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000026252 | 3 retrocopies |
retro_ocun_1411, retro_ocun_368 , retro_ocun_639,
|