RetrogeneDB ID: | retro_ocun_1556 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018700:2982776..2982961(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSOCUG00000029043 | ||
| Aliases: | None | ||
| Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17162] |
| Percent Identity: | 69.84 % |
| Parental protein coverage: | 67.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | NPSQLLPLEL-VDKCIGSRIHIVMKSD-KEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITK |
| N.SQLLPLE...D.C.GSRI..VM.S..KE.VG.LLGFDDFV.M.LEDVTEFEITP.G.R..K | |
| Retrocopy | NLSQLLPLEI>LDTCTGSRIQVVMNSE>KETVGMLLGFDDFVIMILEDVTEFEITPKGGRVAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .79 RPM |
| SRP017611_kidney | 0 .10 RPM | 7 .30 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Homo sapiens | ENSG00000106355 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010325 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000005353 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017028 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029043 | 5 retrocopies | |
| Ochotona princeps | ENSOPRG00000002443 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000026064 | 1 retrocopy |