RetrogeneDB ID: | retro_ggor_2824 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:107120258..107120454(+) | ||
| Located in intron of: | ENSGGOG00000016611 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSGGOG00000010325 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.41 % |
| Parental protein coverage: | 72.53 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MAANATTNP-SQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNM-VLEDVTEFEITPEGRRI |
| MAA.ATT....QLL.LELVDKCIGSRIHIV.KS..EIVGTLLG.DDFVNM..LE.VTEFEITPEGR.I | |
| Retrocopy | MAAKATTYL<AQLLLLELVDKCIGSRIHIVVKSN*EIVGTLLGVDDFVNM<GLEEVTEFEITPEGRSI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .83 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .84 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .36 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .35 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4216 |
| Pan troglodytes | retro_ptro_2862 |
| Pongo abelii | retro_pabe_3449 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Homo sapiens | ENSG00000106355 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010325 | 2 retrocopies |
retro_ggor_2504, retro_ggor_2824 ,
|
| Microcebus murinus | ENSMICG00000005353 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017028 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029043 | 5 retrocopies | |
| Ochotona princeps | ENSOPRG00000002443 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000026064 | 1 retrocopy |