RetrogeneDB ID: | retro_oana_60 | ||
Retrocopylocation | Organism: | Platypus (Ornithorhynchus anatinus) | |
| Coordinates: | Contig260072:631..1051(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AP4S1 | ||
| Ensembl ID: | ENSOANG00000014031 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
| Percent Identity: | 53.57 % |
| Parental protein coverage: | 97.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MIKFFLMVNKQGQTRLSRYYEHIEMNKRILLEAEVIKNCLSRSKEQCSFIEYKDFKLIYRQYAALFIVVG |
| MIKF.LM.NKQGQTRLS.Y.E.......I.LEAEVI..CL.R....CSF......K.IYR.YA.L...VG | |
| Retrocopy | MIKFILMINKQGQTRLSVYFENWPLCNKISLEAEVIRKCLLRDETKCSFFRISHHKIIYRRYASLYLIVG |
| Parental | VNEAENEMAVYELIHNFVEVLDKYFSRVSELDIMFNLDKVHIILDEMLLNGYIVETNKTRILAPLLILDK |
| V...ENE....E.IHN.VE.LDKYF..V.ELDIM.N..K.H.IL.EM...G.IV.T.....L.PL..L.. | |
| Retrocopy | VTDEENELSILEFIHNVVETLDKYFESVCELDIMYNMEKTHYILNEMVSGGSIVDTSTSNLLCPLEVLQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 14 .84 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 16 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 39 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 29 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .96 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
| Homo sapiens | ENSG00000100478 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011671 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy |
retro_oana_60 ,
|
| Pongo abelii | ENSPPYG00000005723 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005765 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |