RetrogeneDB ID: | retro_nleu_2604 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397381.1:459054..459243(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSNLEG00000000320 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 82.54 % |
| Parental protein coverage: | 58.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | FPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKGMHGLRIFTSVPK |
| FP.ATAIKVTD.SGGCG..YEIKIESEE.KEKR.VQ.HQ.VNQAL.EEIKGM.GLRIF.SVPK | |
| Retrocopy | FPLATAIKVTDMSGGCGVIYEIKIESEEVKEKRSVQHHQRVNQALREEIKGMPGLRIFISVPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Homo sapiens | ENSG00000163170 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024505 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000015207 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000320 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012285 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012078 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy |