RetrogeneDB ID: | retro_nleu_1337 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397289.1:10967279..10967510(-) | ||
| Located in intron of: | ENSNLEG00000003566 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C10ORF57 | ||
| Ensembl ID: | ENSNLEG00000010657 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.04 % |
| Parental protein coverage: | 62.6 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | ATAAGAAYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLRNGYWLAWLI |
| A..A.A.YF.........V..L.....TWVVFWP.SI.YQ.LGPL..FTQYLV.HHHT.L..GYWLAWL. | |
| Retrocopy | ASSAAATYFCPARPLPLLVTVLGLDCFTWVVFWPWSILYQSLGPLDSFTQYLVGHHHTILCSGYWLAWLS |
| Parental | HVGESLY |
| HVGESLY | |
| Retrocopy | HVGESLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012986 | 4 retrocopies | |
| Bos taurus | ENSBTAG00000001656 | 1 retrocopy | |
| Homo sapiens | ENSG00000133678 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003613 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000072676 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010657 | 1 retrocopy |
retro_nleu_1337 ,
|
| Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000002293 | 1 retrocopy |