RetrogeneDB ID: | retro_mmus_894 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:106459228..106459499(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000091762 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Uqcrh | ||
| Ensembl ID: | ENSMUSG00000063882 | ||
| Aliases: | Uqcrh, 2210416J04Rik, 2310021J10Rik, 2610041P16Rik | ||
| Description: | ubiquinol-cytochrome c reductase hinge protein [Source:MGI Symbol;Acc:MGI:1913826] |
| Percent Identity: | 83.52 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MGLEDERKMLTGSGDP-KEEEEE-ELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEE |
| MGLED.RKMLTGSGDP.KEEEEE.ELVD.LTTVREH..QL.KCVKA.E.LELCD.RVSSRSQTEEDCTEE | |
| Retrocopy | MGLEDQRKMLTGSGDP>KEEEEEKELVDTLTTVREHLVQLGKCVKAQECLELCDKRVSSRSQTEEDCTEE |
| Parental | LFDFLHARDHCVAHKLFKNLK |
| LFDF.HAR.HCVA.KL.K.LK | |
| Retrocopy | LFDFVHARNHCVAPKLSKSLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 100 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 77 .16 RPM |
| SRP007412_heart | 0 .00 RPM | 262 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 180 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 87 .74 RPM |
| SRP007412_testis | 1 .05 RPM | 33 .62 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_20903 | 308 libraries | 120 libraries | 87 libraries | 204 libraries | 353 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |