RetrogeneDB ID: | retro_ggor_1855 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:71738427..71738621(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000173660 | ||
| Ensembl ID: | ENSGGOG00000010631 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 80.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKAR-ERLELCDERVSSRSHTEE |
| MGLEDE.KMLT.S.D..EEEE.EEEL.DPLTT.REQC.QLEKCVKAR.E.LELCDE..S..S...E | |
| Retrocopy | MGLEDE*KMLTRSEDLMEEEEQEEELLDPLTTEREQCKQLEKCVKAR<EWLELCDECISFQSQRRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 106 .99 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 60 .83 RPM |
| SRP007412_heart | 0 .00 RPM | 65 .82 RPM |
| SRP007412_kidney | 0 .00 RPM | 77 .28 RPM |
| SRP007412_liver | 0 .00 RPM | 25 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 27 .25 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2659 |
| Pan troglodytes | retro_ptro_1792 |
| Pongo abelii | retro_pabe_2314 |
| Callithrix jacchus | retro_cjac_1337 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy |
retro_ggor_1855 ,
|
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |