RetrogeneDB ID: | retro_mmus_878 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:81709143..81709516(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Lamtor2 | ||
| Ensembl ID: | ENSMUSG00000028062 | ||
| Aliases: | Lamtor2, 2010111E04Rik, AL022628, Mapbpip, P14, Rab25, Robld3 | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [Source:MGI Symbol;Acc:MGI:1932697] |
| Percent Identity: | 82.68 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MLRPKALTQVLSQANTGGVQSTLLLNN-EGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQ-AFNEDS |
| ML..KALT.VLSQANTGGVQSTLLLN...G.LLAYS.YGDTDA.VTAAIASN.WA.YD..GNQ.AFNE.. | |
| Retrocopy | MLHLKALTKVLSQANTGGVQSTLLLNK<NGLLLAYSSYGDTDAWVTAAIASNVWAMYDKIGNQ<AFNEAG |
| Parental | LKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
| LKFILMDCMEG.VAITRV.NLLL.M.AKET.GFGMLKAKAQALVQYLE.PLTQVAAS | |
| Retrocopy | LKFILMDCMEGSVAITRVINLLLSMNAKETIGFGMLKAKAQALVQYLE*PLTQVAAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 23 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .13 RPM |
| SRP007412_heart | 0 .06 RPM | 31 .63 RPM |
| SRP007412_kidney | 0 .00 RPM | 44 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 41 .67 RPM |
| SRP007412_testis | 0 .05 RPM | 10 .66 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_25112 | 484 libraries | 199 libraries | 373 libraries | 15 libraries | 1 library |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000009193 | 1 retrocopy | |
| Felis catus | ENSFCAG00000028596 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023871 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028062 | 1 retrocopy |
retro_mmus_878 ,
|
| Otolemur garnettii | ENSOGAG00000016953 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010328 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019908 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000013344 | 1 retrocopy |