RetrogeneDB ID: | retro_mmus_688 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:5634138..5634579(+) | ||
| Located in intron of: | ENSMUSG00000020481 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000081021 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Edf1 | ||
| Ensembl ID: | ENSMUSG00000015092 | ||
| Aliases: | Edf1, 0610008L11Rik, AA409425 | ||
| Description: | endothelial differentiation-related factor 1 [Source:MGI Symbol;Acc:MGI:1891227] |
| Percent Identity: | 95.27 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH |
| MAESDWDTVTVL.KKGPTAAQAKSKQAILAAQRR.EDVETSKKWAAGQNKQHSITKNTAKLD.ETEELHH | |
| Retrocopy | MAESDWDTVTVLCKKGPTAAQAKSKQAILAAQRR-EDVETSKKWAAGQNKQHSITKNTAKLDWETEELHH |
| Parental | DRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP |
| DRV.LEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGK.ERAIGLKLRGKD.GKP | |
| Retrocopy | DRVALEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKTERAIGLKLRGKDVGKP |
| Parental | IEKGPKAK |
| IEKGPKA. | |
| Retrocopy | IEKGPKAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .16 RPM | 38 .74 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 52 .58 RPM |
| SRP007412_heart | 0 .34 RPM | 73 .09 RPM |
| SRP007412_kidney | 0 .23 RPM | 72 .53 RPM |
| SRP007412_liver | 0 .25 RPM | 81 .79 RPM |
| SRP007412_testis | 0 .50 RPM | 90 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013266 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000019544 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011166 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009565 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026812 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000015037 | 7 retrocopies | |
| Microcebus murinus | ENSMICG00000016498 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005051 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017329 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011008 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015092 | 3 retrocopies |
retro_mmus_3324, retro_mmus_688 , retro_mmus_809,
|
| Rattus norvegicus | ENSRNOG00000016272 | 4 retrocopies | |
| Sorex araneus | ENSSARG00000007191 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014060 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002668 | 2 retrocopies |