RetrogeneDB ID: | retro_mmus_438 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:49173162..49173391(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl37 | ||
| Ensembl ID: | ENSMUSG00000041841 | ||
| Aliases: | Rpl37, 3110005M08Rik | ||
| Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 78.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | CGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAV |
| CG...YHLQKSTCGKCGY.AK.KR.YN...KAKR..TT.TG.MRHLKIVY..FR.GF.EGTTPKPKR.AV | |
| Retrocopy | CGYIDYHLQKSTCGKCGYSAKHKRNYNRNSKAKR*YTTRTGMMRHLKIVYCTFRLGFCEGTTPKPKRTAV |
| Parental | AA-SSSS |
| ...SSSS | |
| Retrocopy | VV>SSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 65 .70 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 58 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 45 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
| SRP007412_testis | 0 .00 RPM | 51 .18 RPM |