RetrogeneDB ID: | retro_mmus_1813 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 19:16025498..16025717(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl37 | ||
| Ensembl ID: | ENSMUSG00000041841 | ||
| Aliases: | Rpl37, 3110005M08Rik | ||
| Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
Retrocopy-Parental alignment summary:
>retro_mmus_1813
AAGGCCTACCACCTTCAGAAATTGACTTGTGGCAAATGTGGCTACCCTGTGAAGCGCAAGAAGAAGTATAACTGGAGTGC
CAGGGCTAAGAGACGAAACACTACCGGGACTGATCGGATGAGGCACCTAAAGATTGTCTACCGCAGATTCAGACATGGAT
TCCGTGAGGGAACAACACCTAAACCCAAGAGGGCGGCTGCTGCAGCATCCAGTTCATCT
AAGGCCTACCACCTTCAGAAATTGACTTGTGGCAAATGTGGCTACCCTGTGAAGCGCAAGAAGAAGTATAACTGGAGTGC
CAGGGCTAAGAGACGAAACACTACCGGGACTGATCGGATGAGGCACCTAAAGATTGTCTACCGCAGATTCAGACATGGAT
TCCGTGAGGGAACAACACCTAAACCCAAGAGGGCGGCTGCTGCAGCATCCAGTTCATCT
ORF - retro_mmus_1813 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 91.78 % |
| Parental protein coverage: | 75.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | KAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAAS |
| KAYHLQK.TCGKCGYP.KRK.KYNWSA.AKRRNTTGT.RMRHLKIVYRRFRHGFREGTTPKPKRAA.AAS | |
| Retrocopy | KAYHLQKLTCGKCGYPVKRKKKYNWSARAKRRNTTGTDRMRHLKIVYRRFRHGFREGTTPKPKRAAAAAS |
| Parental | SSS |
| SSS | |
| Retrocopy | SSS |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 65 .70 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 58 .93 RPM |
| SRP007412_kidney | 0 .02 RPM | 45 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 67 .59 RPM |
| SRP007412_testis | 0 .05 RPM | 51 .18 RPM |
RNA Polymerase II actvity near the 5' end of retro_mmus_1813 was not detected
No EST(s) were mapped for retro_mmus_1813 retrocopy.
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_62768 | 201 libraries | 384 libraries | 426 libraries | 54 libraries | 7 libraries |
The graphical summary, for retro_mmus_1813 TSS expression levels > 0 TPM .
TSS expression levels were studied across 1072 TSS-CAGE libraries, based on FANTOM5 data.
The expression values were visualized using beanplot. If you have any doubts, how to read it, read more in Kampstra P (2008)
retro_mmus_1813 was not experimentally validated.